Makale yayınlamak için
Üye Ol Üye Girişi Yap

Ücretsiz Web sitesi Tanıtım Yazısı Projesi
Başvuru ve EğitimBilgisayarlarÇevreEv ve AileFinansİletişimİnternetİşKişisel GelişimModaSağlık ve FitnesSanat ve EğlenceSeyahatSiyasetSporToplumUlaşımÜrün YorumlarıSohbetYiyecek ve İçecek

toplam 1539 makale ve 373 yorum yazıldı.


YAPILAN SON YORUMLAR
(murat kaya) Gece Kurye: Sizlere mesai saatinden sonra da nöbetçi kurye
(Güven MG) Çalışmıyor site sanırım bozuk üzgünüm beğenmedim b
(Salih Akkurt) Nakliyat sektöründe 19. yıl oldu ve binlerce referans olu
(izmir masaj) güzel tanıtım yazmış adam :D helal olsun ellerine sağl
(tuğra güler) çok Güzel ve başarılı bir yorum olmuş... tebrik eder b
(Beşiktaş Karel ) Beşiktaş karel santral servisi http://www.karelsantralserv
(en güzel resimli sözler) Çok güzel bir site tavsiye ederim. Dini resimli sözler an
(Karel Teknik Servis) Karel Santral Teknik Servisi Karel Telefon Santralleri arız
(Avcılar Karel) http://www.karelsantralservisii.com/avcilar-karel-santral-se
(Bakırköy Karel) http://www.karelsantralservisii.com/bakirkoy-karel-santral-s





Çolakoğlu
colakoglunakliye.com.tr
Ulaşım
966 kez okundu ve 0 kez yorumlandı

Evden eve nakliyat hizmeti almak,evinizi istanbul içerisinde taşıtmak istiyorsanız ve ofis taşınması için yapmanız gereken Çolakoğlu Nakliye firması ile iletişime geçerek bilgi almalıs
devamını oku

En ekonomik instagram takipçi paketleri takipcio.
takipcio.com
İnternet
955 kez okundu ve 1 kez yorumlandı

Site ile ilgili açıklamalar Instagramdaki beğeni ve takipçi sayılarınızı arttırmak istiyorsanız, hiç vakit kaybetmeden takipcio.com sitesine giriş yapınız. Site aracılığı ile, büt
devamını oku

Yeni Ve Özgün Haberler İçin Yenibirhaber.net
yenibirhaber.net
İnternet
1043 kez okundu ve 10 kez yorumlandı

Yeni haberler ve özgün içerikler. Dünyadan haberler yeni bir haberde. Ekonomi, emlak, iş dünyası, sağlık, siyaset, yaşam, hobi, oyun, eğlence, müzik, televizyon, kültür, sanat, moda, tek
devamını oku

Skrotpræmie – Skrotbil – Skrotbiler
skrotpriser.com
İş
1382 kez okundu ve 0 kez yorumlandı

Skrotpræmie – Vi Køber alle slags biler, uanset alder og stand. Skal du have solgt din bil her og nu, vil vi gerne give et uforpligtende bud. Ring eller udfyld vores formular det er helt GRATIS at
devamını oku

Web Dünyası - Sosyal İçerik Platformu
goo.gl/rzC2uP
Başvuru ve Eğitim
954 kez okundu ve 0 kez yorumlandı

Web Dünyası, Türkiye\nin dört bir yanındaki milyonlarca insana haber ve eğlence sunan bağımsız dijital medya sitesidir. Küresel sosyal platform ağı, sitemiz ve mobil uygulamamız ile, Face
devamını oku

Magazin365Net
magazin365.net
İletişim
831 kez okundu ve 4 kez yorumlandı

Internette gezinirken ilgimi ceken sosyal icerikli haberleri paylastigim bir haber blogu.Gunun ilgi ceken iceriklerini bir araya toplayip sosyal medyanin ilgi ceken icerikleri bir arada bu blogta topl
devamını oku

koyun ithalatı
koyunithalati.com
Yiyecek ve İçecek
1091 kez okundu ve 0 kez yorumlandı

ithal koyun, koyun ithalatı, merinos koyun, şerole, romanov, Gerekli yatırımlarını tamamlayan gerçek veya tüzel kişilerin işletmelerinin ihtiyacı olan damızlık küçükbaş hayvanların i
devamını oku

Baymak Kombi Servisi
kombi-hizmeti.com/baymak-kombi-servisi
İş
1030 kez okundu ve 10 kez yorumlandı

Baymak kombi servisi Profesyonel servis personellerimizle her daim yanınızdayız. Bizleri aradığınızda personelimiz sizlere en yakın lokasyondaki ekibimizi yönlendireceklerdir. Tek yapmanız g
devamını oku

Ferrucci Saat
firsatsatislari.com
Moda
1050 kez okundu ve 0 kez yorumlandı

www.firsatsatislari.com Web sitemizde ferrucci saatlerine ulaşabilirisiniz. Ferrucci saatlerimiz 2 yıl garantili olup özel kabında sizlere verilicektir. Ferrucci saatleri ucuzdur. Ferrucci For mot
devamını oku

DEV KAMPANYA-IMALATTAN YATAK BAZA BASLIKLAR
kalitist.com
İş
992 kez okundu ve 2 kez yorumlandı

DEV KAMPANYA İMALATTAN SÜNGER ve İŞÇİ YATAKLARI , EKONOMİK ORTOPEDİK ve LUX YAYLI YATAKLAR , SANDIKLI ve OTEL TİPİ ÇELİK BAZALAR , DERİ ve LUX BAŞLIKLAR , ŞANTİYE ve YURT TİPİ RANZA
devamını oku

internetten para kazanma yolları
yazitorstartermoney.blogspot.com.tr
İş
1349 kez okundu ve 0 kez yorumlandı

Günümüzde internet sayesinde binlerce iş imkanı ortaya çıktı. Bunlardan biride makale yazarak internetten para kazanma işidir. Web sitelerinin özgün içerik ihtiyacı günden güne artıyor
devamını oku

fal bilim merkezi
telwecafe.com
Başvuru ve Eğitim
1027 kez okundu ve 1 kez yorumlandı

FAL BİLİM MERKEZİ www.telwecafe.com İZMİRİN EN ÜNLÜ FALCISIYLA TANIŞMAYA HAZIRMISINIZ FALCI ECEM HANIM İZMİRDE 1 NUMARA TANIŞMAYA HAZIR OLUN TANIDIĞINIZ TÜM FALCILARI UNUTUN SİZ UNUTMAS
devamını oku

Masa Tenisi Kuralları, Masa Tenisi Dersleri, Masa
masa-tenisi.net
Spor
1030 kez okundu ve 1 kez yorumlandı

Yeni açılan masa-tenisi.net sitemiz masa tenisi hakkında geniş bilgi veren ve sizlerinde görüşlerinizle büyüyen yeni bir platformdur. Sitemiz, bu spora yeni başlayan kardeşlerimizin tecrüb
devamını oku

İnşaat Firması Scriptleri
hazirscriptler.web.tr/hazir-php-scriptle
İnternet
945 kez okundu ve 0 kez yorumlandı

İnşaat firmaları için hazırladığımız inşaat firma scripti versiyonlarını web sitemizde inceleyiniz. Standart ve mobil uyumlu inşaat firması scripti kategorimizde çok sayıda inşaat scr
devamını oku

Bergama Emlak Sitesi
bergamadakiralik.com
İş
949 kez okundu ve 0 kez yorumlandı

Bergamada Kiralık isimli yeni emlak sitesi Bergamada bulunan müstakil ev, daire, işyeri, dükkan, arsa ve tarla ilanları için yeni bir emlak ilan sitesi olarak yayına başlamış bulunuyor. B
devamını oku

Ankara Nakliyat Firmaları
ankaraevdenevenakliyatfirmalari.com
İş
856 kez okundu ve 0 kez yorumlandı

Ankara ilinde faaliyet gösteren evden eve nakliyat firmaları rehberimizde bölgelere göre listelemiştir. Web sitemizde kayıtlı tüm firmalar Ankara genelinde şehir içi ve yurt genelinde şe
devamını oku

Ücretsiz Script ve Temalar
ucretsiz.script.web.tr
İnternet
957 kez okundu ve 0 kez yorumlandı

Ücretsiz scriptler çoğu zaman hemen kısa sürede hızlıca ve az maliyetle web sitesi hazırlamak için tercih edilmektedir. Sadece bir domain ve hosting satın alarak beğendiğiniz bir ücretsiz
devamını oku

Hazır Emlak Sitesi
haziremlaksitesi.biz.tr
İnternet
1007 kez okundu ve 0 kez yorumlandı

Hazır emlak sitesi paketlerimiz, internetin artık neredeyse her eve ve her cebe girdiği dönemde, emlak ofisleri için internette kurumsal görünümün bir gereği olarak hizmete sunulmuştur. Far
devamını oku

Seyahatlerde işinize çok yarayacak püf noktalar
kutubaligi.com
Seyahat
815 kez okundu ve 0 kez yorumlandı

Seyahat fırsatları, ipuçları ve yolcu hakları. Nereye en ucuz nasıl gidilir? En iyi nasıl gezilir? Gezilecek yerler, görülecek şeyler. Ne yenir ne içilir ve daha bir çok püf noktası hep
devamını oku

Hazır Scriptler
hazirscriptler.web.tr
İnternet
1005 kez okundu ve 0 kez yorumlandı

Hazır Scriptler genelde en kısa zamanda ve en uygun fiyata web sitesi hazırlamak için tercih edilmektedir. Hazır scriptler PHP veya ASP ile kodlanmış yazılımlardır ve web sitesi hazırlaman
devamını oku

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77